PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g06472.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 305aa    MW: 32329.3 Da    PI: 8.3944
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g06472.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.4e-191156147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + 
  Bradi3g06472.1.p 11 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 56
                      79******************************.***********985 PP

2Myb_DNA-binding53.65.1e-1763106146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       r ++T+eEd  +++a+++lG++ W++Iar ++ gRt++ +k++w++
  Bradi3g06472.1.p  63 RRPFTAEEDASILRAHARLGNR-WAAIARLLP-GRTDNAVKNHWNS 106
                       679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.481661IPR017930Myb domain
SuperFamilySSF466892.51E-318104IPR009057Homeodomain-like
SMARTSM007179.6E-171059IPR001005SANT/Myb domain
PfamPF002493.9E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-251264IPR009057Homeodomain-like
CDDcd001673.99E-161355No hitNo description
SMARTSM007174.4E-1562110IPR001005SANT/Myb domain
PROSITE profilePS5129420.46163112IPR017930Myb domain
PfamPF002496.0E-1563106IPR001005SANT/Myb domain
CDDcd001675.21E-1265108No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2365112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGAEAECDRI KGPWSPEEDE ALRRLVERHG ARNWTAIGRG IPGRSGKSCR LRWCNQLSPQ  60
VERRPFTAEE DASILRAHAR LGNRWAAIAR LLPGRTDNAV KNHWNSSLKR KLATATAAWE  120
GDAVSGDGSG SGGESEPPRP CKRASPGPGP ESPTGSDRSE LSHGSGQVFR PVPRAGGFDA  180
IISADVVRPP PPRPEEDPLT SLSLSLPGLD QGFHHDSARS HFQELSPSPR SPSPPPAQPA  240
YPFSGDLVAA MQEMIRAEVR KYMSGVGLPA GCGTGAVGEA CIPQLVEGVM RAAAERVGGV  300
VARQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-4181144110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00653PBMTransfer from LOC_Os02g09480Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3538581e-158DQ353858.1 Triticum aestivum MYB transcription factor TaMYB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147631.11e-151uncharacterized protein LOC100281240
SwissprotQ9FDW12e-68MYB44_ARATH; Transcription factor MYB44
TrEMBLI1HY470.0I1HY47_BRADI; Uncharacterized protein
STRINGBRADI3G06470.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.11e-59myb domain protein r1